| Name | Old Name | Accession | PDBID | Modified | Comment | Year | DOI |
|---|---|---|---|---|---|---|---|
| App1Ba1 | XaxA | CBJ91797.1 | 6GY8 | No | |
2018 | 10.7554/eLife.38017 | App1Ba1 | XaxA | CBJ91797.1 | 6GY6 | No | In complex with App2Ba1 (XaxB) |
2018 | 10.7554/eLife.38017 | App1Ca1 | YaxA | 6EK7_A | 6EK7 | No | |
2018 | 10.1038/s41467-018-04139-2 | App1Ca1 | YaxA | 6EK7_A | 6EL1 | No | |
2018 | 10.1038/s41467-018-04139-2 | App2Aa1 | PaxB | WP_046395991 | 6EK4 | No | |
2018 | 10.1038/s41467-018-04139-2 | App2Ba1 | XaxB | CBJ91798.1 | 6GY7 | No | |
2018 | 10.7554/eLife.38017 | App2Ba1 | XaxB | CBJ91798.1 | 6GY6 | No | In Complex with App1Ba1 (XaxA) |
2018 | 10.7554/eLife.38017 | App3Aa1 | YaxB | WP_011816274 | 6EL1 | No | |
2018 | 10.1038/s41467-018-04139-2 | App6Aa1, App6Aa2 | Cry6Aa1, Cry6Aa2 | AAA22357, AAM46849 | 5KUD | Sequence in the structure matches App6Aa1, App6Aa2 |
2016 | 10.1186/s12915-016-0295-9 | App6Aa1, App6Aa2 | Cry6Aa1, Cry6Aa2 | AAA22357, AAM46849 | 5KUC | Trypsin activated. Sequence in the structure matches App6Aa1, App6Aa2 |
2016 | 10.1186/s12915-016-0295-9 | App6Aa1, App6Aa2 | Cry6Aa1, Cry6Aa2 | AAA22357, AAM46849 | 5GHE | Activated, major chain. Sequence in the structure matches App6Aa1, App6Aa2 |
2016 | 10.1016/j.bbrc.2016.07.002 | Cry Chimera | None | 6DJ4_A | 6DJ4 | Yes | Chimera of Cry1Ab, 1Ac, 1F: does not associate with a single database entry. Described as Cry1A.105 |
2018 | 10.1016/j.yrtph.2018.09.003 | Cry chimera | None | 6OWK_A | 6OWK | Yes | Chimeric protein (named "Cry1B tryptic core variant" in publication). This is a disabled insecticidal protein mutant [A160N,N167D] of an artificial chimera Cry1B.867: a fusion of domains 1+2 of Cry1Be5 with domain 3 of Cry1Ka2 (residues 1-502 and 473-621 respectively with reference to the parental genes). |
2019 | 10.1128/AEM.00579-19 | Cry variant | None | 6WPC_A | 6WPC | Yes | Non-natural Cry variant named Cry1A.2, tryptic core |
2021 | 10.1371/journal.pone.0249150 | Cry11Aa1, Cry11Aa3 | CryIVD, Cry11Aa3 | AAA22352, CAD30081 | 7QX5 | Yes | Y449F mutant pH7 natural crystals. Sequence also matches Cry11Aa3 (CAD30081) |
2022 | 10.1038/s41467-022-31746-x | Cry11Aa1, Cry11Aa3 | CryIVD, Cry11Aa3 | AAA22352, CAD30081 | 7QX7 | Yes | F17Y mutant, pH7 natural crystals. Sequence also matches Cry11Aa3 (CAD30081) |
2022 | 10.1038/s41467-022-31746-x | Cry11Aa1, Cry11Aa3 | CryIVD, Cry11Aa3 | AAA22352, CAD30081 | 7QX4 | No | pH7 natural crystals. Sequence also matches Cry11Aa3 (CAD30081) |
2022 | 10.1038/s41467-022-31746-x | Cry11Aa1, Cry11Aa3 | CryIVD, Cry11Aa3 | AAA22352, CAD30081 | 7QX6 | Yes | E583Q mutant, pH7 natural crystals. Sequence also matches Cry11Aa3 (CAD30081) |
2022 | 10.1038/s41467-022-31746-x | Cry11Ba1 | Jeg80 | CAA60504 | 7R1E | No | pH10.4 natural crystals |
2022 | 10.1038/s41467-022-31746-x | Cry11Ba1 | Jeg80 | CAA60504 | 7QYD | No | pH6.5 natural crystals |
2022 | 10.1038/s41467-022-31746-x | Cry1Aa | None | None | 8W7N | No | Full length Cry1Aa protoxin by serial synchrotron rotation crystallography
NOTE sequence in pdb file does not match sequence from supplementary figure 2 in the paper so the exact sequence is unclear. |
2023 | 10.1016/j.bbrc.2023.149144 | Cry1Aa6 | CryIA(a) | AAA86265 | 1CIY | No | |
1997 | 10.1006/jmbi.1995.0630 | Cry1Ac4 | Cry1Ac4 | AAA73077 | 4W8J | Yes | Full-length (133 kDa) protoxin: 14x Cys-Ser and F462V mutant of Cry1Ac4 |
2014 | 10.1002/pro.2536 | Cry1Ac7, Cry1Ac8 | Cry1Ac7, Cry1Ac8 | AAB46989, AAC44841 | 4ARY | No | Bound to GalNAc |
2013 | 10.1107/s090744490101040x | Cry1Ac7, Cry1Ac8 | Cry1Ac7, Cry1Ac8 | AAB46989, AAC44841 | 4ARX | No | |
2013 | 10.1107/s090744490101040x | Cry1Ca18 | Cry1Ca18 | PQ691233 | 9H99 | No | pH7 Full length protoxin structure of natural crystals by XFEL |
2026 | 10.1016/j.str.2026.01.014 | Cry1Ca18 | Cry1Ca18 | PQ691233 | 9QXQ | No | pH9 Full length protoxin structure of natural crystals by XFEL |
2026 | 10.1016/j.str.2026.01.014 | Cry1Da1 | Cry1Da1 | CAA38099 | 6OVB | Yes | V108C, E128C, S282V, Y316S, I368P mutant of Cry1Da1 |
2019 | 10.1128/AEM.00579-19 | Cry2Aa | Cry2Aa | multiple, see comments | 1I5P | No | Sequence in the structure matches Cry2Aa1, Cry2Aa2, Cry2Aa9, Cry2Aa10, Cry2Aa19, Cry2Aa20, Cry2Aa21 (AAA22335, AF433645, AYN72228, AAA83516, AYN72229, AYN72230, AAO13750) |
2001 | 10.1016/s0969-2126(01)00601-3 | Cry3Aa | Cry3Aa | multiple, see comments | 6LFP | Co-crystalised in vivo with an entrapped recombinant lipase. Sequence in structure matches Cry3Aa2, Cry3Aa3, Cry3Aa5, Cry3Aa6, Cry3Aa12 (AAA22541, CAA68482, AAA50255, AAC43266, ABY49136) |
2020 | 10.1021/jacs.9b13462 | Cry3Aa | Cry3Aa | multiple, see comments | 1DLC | No | Sequence in structure matches Cry3Aa2, Cry3Aa3, Cry3Aa5, Cry3Aa6, Cry3Aa12 (AAA22541, CAA68482, AAA50255, AAC43266, ABY49136) |
1994 | 10.1038/353815a0 | Cry3Aa | Cry3Aa | multiple, see comments | 7EAR | Yes | Positive charged mutant with multiple mutations (N391K, N395K, E423K, Q430K, D432K, E433K, T436K, T461K, D462K, E463K, E466K). Sequence in structure matches Cry3Aa2, Cry3Aa3, Cry3Aa5, Cry3Aa6, Cry3Aa12 (AAA22541, CAA68482, AAA50255, AAC43266, ABY49136) with above mutations |
2021 | 10.1016/j.biomaterials.2021.120759 | Cry3Aa | Cry3Aa | multiple, see comments |
4QX0,
4QX1, 4QX2, 4QX3, |
No | XFEL structure from natural crystals. Sequence in structure matches Cry3Aa2, Cry3Aa3, Cry3Aa5, Cry3Aa6, Cry3Aa12 (AAA22541, CAA68482, AAA50255, AAC43266, ABY49136) |
2014 | 10.1073/pnas.1413456111 | Cry3Bb1 | Cry3Bb1 | AAA22334 | 1JI6 | No | |
2001 | 10.1107/s0907444901008186 | Cry4Aa1 | Cry4Aa1 | CAA68485 | 2C9K | No | |
2006 | 10.1128/JB.188.9.3391-3401.2006 | Cry4Ba1 | Cry4Ba1 | CAA30312 | 4MOA | Yes | R203Q mutant |
2014 | 10.1074/jbc.M114.627554 | Cry4Ba1 | Cry4Ba1 | CAA30312 | 1W99 | No | |
2005 | 10.1016/j.jmb.2005.02.013 | Cry5Ba1 | Cry5Ba1 | AAA68598 | 4D8M | No | |
2012 | 10.1021/bi301386q | Cry5Ba2 | None | ABW88931 | 8HHE | No | Activated protein |
2022 | 10.3390/toxins14120823 | Cry7Ca1 | Cry7Ca1 | ABR67863 | 5ZI1 | Yes | |
2018 | 10.1002/pro.3561 | Cry8Ba2 | Cry8Ba2 | MZ355710 | 9H9A | No | Extended form, full length protoxin structure of natural crystals by XFEL |
2026 | 10.1016/j.str.2026.01.014 | Cry8Ba2 | Cry8Ba2 | MZ355710 | 9H9B | No | Compressed form, full length protoxin structure of natural crystals by XFEL |
2026 | 10.1016/j.str.2026.01.014 | Cry8Ea1 | Cry8Ea1 | AY329081 | 3EB7 | No | |
2008 | 10.1016/j.jsb.2009.07.004 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | CAA26943, CAA27868, CAD30079 | 6T19 | No | Sequence in the structure matches Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 |
2020 | 10.1038/s41467-020-14894-w | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | CAA26943, CAA27868, CAD30079 | 6T1C | Yes | Cys7Ser mutant. Sequence in the structure matches Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 with mutation above |
2020 | 10.1038/s41467-020-14894-w | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | CAA26943, CAA27868, CAD30079 | 6T1A | No | pH10. Sequence in the structure matches Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 |
2020 | 10.1038/s41467-020-14894-w | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | CAA26943, CAA27868, CAD30079 | 3RON | No | Sequence in the structure matches Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 |
2011 | 10.1016/j.jmb.2011.09.021 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 | CAA26943, CAA27868, CAD30079 | 6T14 | No | pH7. Sequence in the structure matches Cyt1Aa1, Cyt1Aa2, Cyt1Aa5 |
2020 | 10.1038/s41467-020-14894-w | Cyt2Aa1, Cyt2Aa2, Cyt2Aa4 | Cyt2Aa1, Cyt2Aa2, Cyt2Aa4 | multiple, see comments | 1CBY | No | Sequence in structure matches Cyt2Aa1, Cyt2Aa2, Cyt2Aa4 (CAA78519, CAA78519, AAM09651) |
1996 | 10.1006/jmbi.1996.0152 | Cyt2Ba | Cyt2Ba | multiple, see comments | 2RCI | No | Sequence in structure matches Cyt2Ba1, Cyt2Ba7, Cyt2Ba9, Cyt2Ba10, Cyt2Ba12, Cyt2Ba13, Cyt2Ba14, Cyt2Ba15 (ACX54359, AAF37222, CAD30094, ACX54358, ACX54360, ACI42304, ACI42305, AEL29854) |
2008 | 10.1016/j.jmb.2011.09.021 | Cyt5Aa1 | Cyt5Aa1 | WP_013316150 | 2MLW | No | |
2015 | 10.1038/srep08791 | Gpp34Ab1 | Cry34Ab1 | AAG41671 | 4JOX | No | |
2013 | 10.1371/journal.pone.0112555 | Mcf1Aa1 | Mcf1 | None | 8P52 | No | |
2023 | 10.1038/s41467-023-44069-2 | Mcf1Aa1 C1397A d15C – Arf | None | None | 8P50 | Yes | Complex of Mcf1Aa1 C1397A delta15C with Arf3 |
None | 10.1038/s41467-023-44069-2 | Mcf1Aa1 C1397A delta15C | None | None | 8P51 | Yes | |
2023 | 10.1038/s41467-023-44069-2 | Mpf1Aa1 | PluMACPF | 2QP2_A | 2QP2 | No | |
2007 | 10.1126/science.1144706 | Mpf2Ba1 | None | None | 8B6W | Mpf2Ba1 pore form (21-mer) |
None | 10.1038/s41467-023-39891-7 | Mpf2Ba1 | None | None | 8B6V | Mpf2Ba1 prepore form (22-mer) |
None | 10.1038/s41467-023-39891-7 | Mpf2Ba1 | None | None | 8B6U | Mpf2Ba1 monomeric form |
None | 10.1038/s41467-023-39891-7 | Mpf3Aa1 | GNIP1Aa | AML23188 | 6FBM | No | |
2019 | 10.1073/pnas.1815547116 | Mpp-like | None | PDB: 2D42_A | 2D42 | No | Structure of an Mpp-like protein from a Bt strain. No activity reported so currently not in the official nomenclature.
Sequence:
AIINLLRELEIYGMQYANSHQYTYGSSYSDDTNPIRIAGLDARIPDPIVTDPVNHIVLDRRIITNTTSNSLEGVFSFSNAYTSRTSSQTRDGVTAGTNITGKYFANLFFEQVGLSGRIAFEGAVTNENKYTLDATQDFRDSQTIRVPPFHRATGVYTLEQGAFEKMTVLECVVSGNGIIRYYRTLPDNSYTEIVQRVNIIDVLQANGTPGFTISKEQNRAYFTGEGTISGQIGLQTFIDVVIEPLPGHA |
2006 | 10.1002/prot.20843 | Mpp23Aa1 | Cry23Aa1 | AAF76375 | 4RHZ | No | Co-crystalised with Xpp37Aa1 |
2014 | Unpublished | Mpp46Aa1 | Cry46Aa1 | BAC79010 | 2ZTB | No | |
2009 | 10.1016/j.jmb.2008.12.002 | Mpp51Aa1 | Cry51Aa1 | ABI14444 | 4PKM | No | |
2015 | 10.1016/j.bbrc.2015.04.068 | Mpp51Aa2 | Cry51Aa2 | BAD22577 | 5HD2 | Yes | L11M mutant |
2016 | 10.1038/ncomms12213 | Mpp5Ac1 | Sip1Ab | AKA64626 | 8HX3 | No | Described as Sip1Ab in publication |
2023 | 10.1002/ps.7622 | Mpp75Aa1 | Cry75Aa1 | ASY04853 | 7ML9 | No | |
2021 | 10.1371/journal.pone.0258052 | Mtx1Aa1 | Mtx1 | AAA22601 | 2CB4 | Yes | Catalytic domain E195Q mutant |
2006 | 10.1016/j.jmb.2006.01.025 | Mtx1Aa1 | Mtx1 | AAA22601 | 2VSE | No | |
2008 | 10.1016/j.jmb.2008.05.067 | Mtx1Aa1 | Mtx1 | AAA22601 | 2VSA | No | |
2008 | 10.1016/j.jmb.2008.05.067 | Mtx1Aa1 | Mtx1 | AAA22601 | 2CB6 | Yes | Catalytic domain E195Q mutant |
2006 | 10.1016/j.jmb.2006.01.025 | Pra1 from P. akhurstii K1 | PirA | None | 7FCN | |
2023 | 10.1016/j.ibmb.2023.104014 | Pra2Aa1 | PirA | 3X0T_A | 3X0T | No | |
2015 | 10.1073/pnas.1503129112 | Prb1 from P. akhurstii K1 | PirB | None | 7FDP | |
2023 | 10.1016/j.ibmb.2023.104014 | Prb2Aa1 | PirB | 3X0U_A | 3X0U | No | |
2015 | 10.1073/pnas.1503129112 | Tpp1Aa2 | BinA2 | WP_012291791 | 5G37 | No | Natural co-crystal with Tpp2Aa2, pH5 |
2016 | 10.1038/nature19825 | Tpp1Aa2 | BinA2 | WP_012291791 | 5FOZ | No | Natural co-crystal with Tpp2Aa2, pH10 |
2016 | 10.1038/nature19825 | Tpp1Aa2 | BinA2 | WP_012291791 | 5FOY | No | Natural co-crystal with Tpp2Aa2, pH7 |
2016 | 10.1038/nature19825 | Tpp2Aa2 | BinB2 | WP_012291792 | 5FOY | No | Natural co-crystal with Tpp1Aa2, pH7 |
2016 | 10.1038/nature19825 | Tpp2Aa2 | BinB2 | WP_012291792 | 5FOZ | No | Natural co-crystal with Tpp1Aa2, pH10 |
2016 | 10.1038/nature19825 | Tpp2Aa2 | BinB2 | WP_012291792 | 5G37 | No | Natural co-crystal with Tpp1Aa2, pH5 |
2016 | 10.1038/nature19825 | Tpp2Aa3 | BinB3 | WP_036216621 | 3WA1 | No | |
2014 | 10.1002/prot.24636 | Tpp35Ab1 | Cry35Ab1 | AAG41672 | 4JP0 | No | |
2014 | 10.1371/journal.pone.0112555 | Tpp49Aa1 | Cry49Aa1 | CAH56541 | 8BEY | No | XFEL structure of natural crystals, pH7 |
2023 | 10.1073/pnas.2203241120 | Tpp49Aa1 | Cry49Aa1 | CAH56541 | 8BEX | No | XFEL structure of natural crystals, pH3 |
2023 | 10.1073/pnas.2203241120 | Tpp49Aa1 | Cry49Aa1 | CAH56541 | 8BEZ | No | XFEL structure of natural crystals, pH11 |
2023 | 10.1073/pnas.2203241120 | Tpp78Aa1 | Cry78Aa1 | ATY50144 | 7Y79 | Yes | Residues 155-359 (lacking N-terminal domain) |
2022 | 10.1038/s42003-022-03754-6 | Tpp78Aa1 | Cry78Aa1 | ATY50144 | 7Y78 | No | Residues 13-359 |
2022 | 10.1038/s42003-022-03754-6 | Tpp80Aa1 | Cry80Aa1 | QCT24227 | 8BAD | No | |
2022 | 10.3390/toxins14120863 | Txp1Aa1, Txp1Aa2 | Txp40A24, Txp40b | ABB29480, Q306L3 | 7xbj | No | Sequence in structure matches Txp1Aa1, Txp1Aa2 |
2023 | Vip3Aa | None | multiple, see comments | 6VLS | No | Trypsin activated fragment: truncated, non-active. Sequence in structure matches Vip3Aa7, Vip3Aa10, Vip3Aa11, Vip3Aa12, Vip3Aa15, Vip3Aa21, Vip3Aa33, Vip3Aa34, Vip3Aa36, Vip3Aa37, Vip3Aa43, Vip3Aa44, Vip3Aa55, Vip3Aa64 (AAK95326, AAN60738, AAR36859, AAM22456, AAP51131, ABD84410, ACY38212, ACY38213, ADF43020, ADJ18213, ADY76643, ADW66453, AIA96502, ASK51084) |
2020 | 10.3390/toxins12070438 | Vip3Aa90 | None | AAW65132 | 6TFK | Described in publication and PDB as Vip3Aa16 but protein used was Vip3Aa90. Note in structure residue 121 is shown as Leu but it is, in fact, Ile.
Trypsin activated |
2020 | 10.1038/s41467-020-17758-5 | Vip3Aa90 | None | AAW65132 | 6TFJ | Described in publication and PDB as Vip3Aa16 but protein used was Vip3Aa90. Note in structure residue 121 is shown as Leu but it is, in fact, Ile. |
2020 | 10.1038/s41467-020-17758-5 | Vip3Bc1 | Vip3Bc1 | ATD53733 | 6YRF | No | |
2020 | 10.1038/s41467-021-23146-4 | Vip3Bc1 | Vip3Bc1 | ATD53733 | 7NTX | No | Trypsin activated |
2020 | 10.1038/s41467-021-23146-4 | Vip3Bc1 | Vip3Bc1 | ATD53733 | 6V1V | Yes | Multiple mutant form |
2019 | 10.1002/pro.3803 | Vip3Bc1 | Vip3Bc1 | ATD53733 | 6YRG | No | Trypsin activated (residues at tip of pore region constructed by homology modelling) |
2020 | 10.1038/s41467-021-23146-4 | Vip3Cb1 | None | LQ835767 | 9EFG | No | Vip3Cb1 activated toxin |
2025 | Vip3Cb1 | None | LQ835767 | 9EFI | No | Protoxin structure |
2025 | Vpa2Aa3 | Vip2Aa3 | AEH05931 | 1QS1 | No | |
1999 | 10.1038/13300 | Vpa2Aa3 | Vip2Aa3 | AEH05931 | 1QS2 | No | With bound NAD |
1999 | 10.1038/13300 | Vpa2Ag1 | Vip2Ag1 | None | 9VEJ | No | Vpa2Ag1 in complex with hexameric Vpb1Ad1 pore |
None | 10.1038/s41467-026-71211-7 | Vpa2Ag1 | Vip2Ag1 | None | 9VEG | No | Vpa2Ag1 in 1:5 complex with Vpb1Ad1 |
2026 | 10.1038/s41467-026-71211-7 | Vpb1Ac1 | Vip1Ac1 | AEH05932 | 6SMS | No | |
2021 | Unpublished | Vpb1Ad1 | Vip1Ad1 | None | 9VEK | No | Vpb1Ad1 hexameric pore |
2026 | 10.1038/s41467-026-71211-7 | Vpb1Ad1 | Vip1Ad1 | None | 9VEJ | No | Vpb1Ad1 hexmeric pore with bound Vpa1Ag1 |
2026 | 10.1038/s41467-026-71211-7 | Vpb1Ad1 | Vip1Ad1 | None | 9VEG | No | Vpb1Ad1 in 5:1 complex with Vpa2Ag1 |
2026 | 10.1038/s41467-026-71211-7 | Vpb4Da2 | Vpb4Da2 | AZJ95709 | 7MJR | Yes | Q530Y-E531Y-K532Y mutant. Sequences matches Vpb4Da1 (AJT49287) and Vpb4Da2 with mutant above |
2021 | 10.1371/journal.pone.0260532 | Xpp37Aa1 | Cry37Aa1 | AAF76376 | 4RHZ | No | Co-crystalised with Mpp23Aa1 |
2015 | Unpublished |